PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI06G12920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YB
Protein Properties Length: 252aa    MW: 26265.3 Da    PI: 5.8371
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI06G12920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB158.11.4e-4927121195
            NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                      vreqdr++Pianv+rim++vlP +akis+dake++qecvsefisfvt+ea+d+c+re+rkt++++dl+wa+  lGf+dyv pl+vyl++ re e
  OMERI06G12920.1  27 VREQDRLMPIANVIRIMRRVLPPHAKISDDAKEVIQECVSEFISFVTGEANDRCHREHRKTVTAEDLVWAMDRLGFDDYVPPLTVYLRRMREYE 120
                      69******************************************************************************************98 PP

            NF-YB  95 g 95 
                      +
  OMERI06G12920.1 121 S 121
                      6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-4526122IPR009072Histone-fold
SuperFamilySSF471133.88E-3630125IPR009072Histone-fold
PfamPF008082.6E-243497IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.8E-136179No hitNo description
PROSITE patternPS0068506480IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.8E-138098No hitNo description
PRINTSPR006153.8E-1399117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MEPAFPNGGA AAPAPAMSAE QPPPAVVREQ DRLMPIANVI RIMRRVLPPH AKISDDAKEV  60
IQECVSEFIS FVTGEANDRC HREHRKTVTA EDLVWAMDRL GFDDYVPPLT VYLRRMREYE  120
SGGSGGGGGG GRGAAAAAPA LVRGGDRSAP PPPPEDAFRY VQVHHPVYAA PGEPVQGYYP  180
VAMSSALPAP HVHVGVRGGG QHEVFGGGPA PLAVYYGGAP YGEASSRGGC SAADEGSSSS  240
SASPAPVGPN YE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-3728118393NF-YB
4awl_B1e-3728118494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-3728118494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642670.11e-125PREDICTED: nuclear transcription factor Y subunit B-9
TrEMBLA0A0E0E0N01e-180A0A0E0E0N0_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g17480.11e-125(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-52nuclear factor Y, subunit B6